C3orf33,AC3-33
  • C3orf33,AC3-33

Anti-C3orf33 Antibody 25ul

Ref: AN-HPA037663-25ul
Anti-C3orf33

Información del producto

Polyclonal Antibody against Human C3orf33, Gene description: chromosome 3 open reading frame 33, Alternative Gene Names: AC3-33, FLJ31139, Validated applications: ICC, IHC, Uniprot ID: Q6P1S2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C3orf33
Gene Description chromosome 3 open reading frame 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQL
Immunogen RLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AC3-33, FLJ31139
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P1S2
HTS Code 3002150000
Gene ID 285315
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C3orf33 Antibody 25ul

Anti-C3orf33 Antibody 25ul