PIK3C2A,PI3K-C2alpha
  • PIK3C2A,PI3K-C2alpha

Anti-PIK3C2A Antibody 100ul

Ref: AN-HPA037642-100ul
Anti-PIK3C2A

Información del producto

Polyclonal Antibody against Human PIK3C2A, Gene description: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha, Alternative Gene Names: PI3K-C2alpha, Validated applications: IHC, Uniprot ID: O00443, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PIK3C2A
Gene Description phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDFPSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDK
Immunogen CGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDFPSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PI3K-C2alpha
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00443
HTS Code 3002150000
Gene ID 5286
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PIK3C2A Antibody 100ul

Anti-PIK3C2A Antibody 100ul