ARHGEF28,p190RhoGEF
  • ARHGEF28,p190RhoGEF

Anti-ARHGEF28 Antibody 100ul

Ref: AN-HPA037602-100ul
Anti-ARHGEF28

Información del producto

Polyclonal Antibody against Human ARHGEF28, Gene description: Rho guanine nucleotide exchange factor (GEF) 28, Alternative Gene Names: p190RhoGEF, RGNEF, RIP2, Validated applications: ICC, IHC, Uniprot ID: Q8N1W1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGEF28
Gene Description Rho guanine nucleotide exchange factor (GEF) 28
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Immunogen GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p190RhoGEF, RGNEF, RIP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N1W1
HTS Code 3002150000
Gene ID 64283
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARHGEF28 Antibody 100ul

Anti-ARHGEF28 Antibody 100ul