FAM175B,ABRO1
  • FAM175B,ABRO1

Anti-FAM175B Antibody 25ul

Ref: AN-HPA037592-25ul
Anti-FAM175B

Información del producto

Polyclonal Antibody against Human FAM175B, Gene description: family with sequence similarity 175, member B, Alternative Gene Names: ABRO1, Em:AC068896.4, KIAA0157, Validated applications: IHC, Uniprot ID: Q15018, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM175B
Gene Description family with sequence similarity 175, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DVEKSERVVESCQAEVNKLRRQITQRKNEKEQERRLQQAVLSRQMPSESLDPAFSPRMPSSGFAAEGRSTLGDA
Immunogen DVEKSERVVESCQAEVNKLRRQITQRKNEKEQERRLQQAVLSRQMPSESLDPAFSPRMPSSGFAAEGRSTLGDA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABRO1, Em:AC068896.4, KIAA0157
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15018
HTS Code 3002150000
Gene ID 23172
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM175B Antibody 25ul

Anti-FAM175B Antibody 25ul