C1D,LRP1,SUN-CoR
  • C1D,LRP1,SUN-CoR

Anti-C1D Antibody 100ul

Ref: AN-HPA037588-100ul
Anti-C1D

Información del producto

Polyclonal Antibody against Human C1D, Gene description: C1D nuclear receptor corepressor, Alternative Gene Names: LRP1, SUN-CoR, SUNCOR, Validated applications: IHC, Uniprot ID: Q13901, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1D
Gene Description C1D nuclear receptor corepressor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
Immunogen MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LRP1, SUN-CoR, SUNCOR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13901
HTS Code 3002150000
Gene ID 10438
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1D Antibody 100ul

Anti-C1D Antibody 100ul