PCBD1,DCOH,PCBD,PCD
  • PCBD1,DCOH,PCBD,PCD

Anti-PCBD1 Antibody 25ul

Ref: AN-HPA037575-25ul
Anti-PCBD1

Información del producto

Polyclonal Antibody against Human PCBD1, Gene description: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha, Alternative Gene Names: DCOH, PCBD, PCD, Validated applications: ICC, IHC, Uniprot ID: P61457, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCBD1
Gene Description pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR
Immunogen MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DCOH, PCBD, PCD
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61457
HTS Code 3002150000
Gene ID 5092
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCBD1 Antibody 25ul

Anti-PCBD1 Antibody 25ul