CCDC34,L15
  • CCDC34,L15

Anti-CCDC34 Antibody 25ul

Ref: AN-HPA037574-25ul
Anti-CCDC34

Información del producto

Polyclonal Antibody against Human CCDC34, Gene description: coiled-coil domain containing 34, Alternative Gene Names: L15, NY-REN-41, RAMA3, Validated applications: ICC, IHC, WB, Uniprot ID: Q96HJ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCDC34
Gene Description coiled-coil domain containing 34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
Immunogen DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L15, NY-REN-41, RAMA3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HJ3
HTS Code 3002150000
Gene ID 91057
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC34 Antibody 25ul

Anti-CCDC34 Antibody 25ul