DNAH12,DHC3,DLP12
  • DNAH12,DHC3,DLP12

Anti-DNAH12 Antibody 25ul

Ref: AN-HPA037493-25ul
Anti-DNAH12

Información del producto

Polyclonal Antibody against Human DNAH12, Gene description: dynein, axonemal, heavy chain 12, Alternative Gene Names: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19, Validated applications: IHC, Uniprot ID: Q6ZR08, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAH12
Gene Description dynein, axonemal, heavy chain 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Immunogen IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZR08
HTS Code 3002150000
Gene ID 201625
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DNAH12 Antibody 25ul

Anti-DNAH12 Antibody 25ul