PCYOX1L,MGC3265
  • PCYOX1L,MGC3265

Anti-PCYOX1L Antibody 25ul

Ref: AN-HPA037463-25ul
Anti-PCYOX1L

Información del producto

Polyclonal Antibody against Human PCYOX1L, Gene description: prenylcysteine oxidase 1 like, Alternative Gene Names: MGC3265, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NBM8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCYOX1L
Gene Description prenylcysteine oxidase 1 like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LYQVAYENEVGNSSDFYDIVVIATPLHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPK
Immunogen LYQVAYENEVGNSSDFYDIVVIATPLHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC3265
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NBM8
HTS Code 3002150000
Gene ID 78991
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCYOX1L Antibody 25ul

Anti-PCYOX1L Antibody 25ul