TRNT1,CCA1,CGI-47
  • TRNT1,CCA1,CGI-47

Anti-TRNT1 Antibody 25ul

Ref: AN-HPA036938-25ul
Anti-TRNT1

Información del producto

Polyclonal Antibody against Human TRNT1, Gene description: tRNA nucleotidyl transferase, CCA-adding, 1, Alternative Gene Names: CCA1, CGI-47, MtCCA, Validated applications: ICC, IHC, WB, Uniprot ID: Q96Q11, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRNT1
Gene Description tRNA nucleotidyl transferase, CCA-adding, 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC, ICC
Sequence LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Immunogen LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCA1, CGI-47, MtCCA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96Q11
HTS Code 3002150000
Gene ID 51095
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRNT1 Antibody 25ul

Anti-TRNT1 Antibody 25ul