RIF1,FLJ10599
  • RIF1,FLJ10599

Anti-RIF1 Antibody 100ul

Ref: AN-HPA036887-100ul
Anti-RIF1

Información del producto

Polyclonal Antibody against Human RIF1, Gene description: replication timing regulatory factor 1, Alternative Gene Names: FLJ10599, FLJ12870, Validated applications: ICC, IHC, Uniprot ID: Q5UIP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RIF1
Gene Description replication timing regulatory factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ELNVGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLNAKEVATEEFNSDISLSDNTTPVKLNAQTEISEQTAAGELDGGNDVSDLHSS
Immunogen ELNVGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLNAKEVATEEFNSDISLSDNTTPVKLNAQTEISEQTAAGELDGGNDVSDLHSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10599, FLJ12870
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5UIP0
HTS Code 3002150000
Gene ID 55183
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RIF1 Antibody 100ul

Anti-RIF1 Antibody 100ul