DNAH1,DNAHC1,HDHC7
  • DNAH1,DNAHC1,HDHC7

Anti-DNAH1 Antibody 25ul

Ref: AN-HPA036806-25ul
Anti-DNAH1

Información del producto

Polyclonal Antibody against Human DNAH1, Gene description: dynein, axonemal, heavy chain 1, Alternative Gene Names: DNAHC1, HDHC7, HL-11, HL11, XLHSRF-1, Validated applications: IHC, Uniprot ID: Q9P2D7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAH1
Gene Description dynein, axonemal, heavy chain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFS
Immunogen RIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNAHC1, HDHC7, HL-11, HL11, XLHSRF-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2D7
HTS Code 3002150000
Gene ID 25981
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DNAH1 Antibody 25ul

Anti-DNAH1 Antibody 25ul