TEX15,CT42
  • TEX15,CT42

Anti-TEX15 Antibody 100ul

Ref: AN-HPA036799-100ul
Anti-TEX15

Información del producto

Polyclonal Antibody against Human TEX15, Gene description: testis expressed 15, Alternative Gene Names: CT42, Validated applications: ICC, Uniprot ID: Q9BXT5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TEX15
Gene Description testis expressed 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence STQNNETELTSPILLPDLQIKITNIFRPGFSPTADSLALKDSFCTHVTEATKPEINKEDGEILGFDIYSQPFGENADYPCEDKVDNIRQESGPVSNSEISLSFDLSR
Immunogen STQNNETELTSPILLPDLQIKITNIFRPGFSPTADSLALKDSFCTHVTEATKPEINKEDGEILGFDIYSQPFGENADYPCEDKVDNIRQESGPVSNSEISLSFDLSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT42
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXT5
HTS Code 3002150000
Gene ID 56154
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TEX15 Antibody 100ul

Anti-TEX15 Antibody 100ul