GTDC1,FLJ11753
  • GTDC1,FLJ11753

Anti-GTDC1 Antibody 100ul

Ref: AN-HPA036694-100ul
Anti-GTDC1

Información del producto

Polyclonal Antibody against Human GTDC1, Gene description: glycosyltransferase-like domain containing 1, Alternative Gene Names: FLJ11753, Hmat-Xa, Validated applications: ICC, IHC, WB, Uniprot ID: Q4AE62, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GTDC1
Gene Description glycosyltransferase-like domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence HWGYLPSKDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIAPFSWAAL
Immunogen HWGYLPSKDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIAPFSWAAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11753, Hmat-Xa
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4AE62
HTS Code 3002150000
Gene ID 79712
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTDC1 Antibody 100ul

Anti-GTDC1 Antibody 100ul