HTRA1,ARMD7,HtrA
  • HTRA1,ARMD7,HtrA

Anti-HTRA1 Antibody 100ul

Ref: AN-HPA036655-100ul
Anti-HTRA1

Información del producto

Polyclonal Antibody against Human HTRA1, Gene description: HtrA serine peptidase 1, Alternative Gene Names: ARMD7, HtrA, IGFBP5-protease, PRSS11, Validated applications: ICC, Uniprot ID: Q92743, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HTRA1
Gene Description HtrA serine peptidase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA
Immunogen GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARMD7, HtrA, IGFBP5-protease, PRSS11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92743
HTS Code 3002150000
Gene ID 5654
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HTRA1 Antibody 100ul

Anti-HTRA1 Antibody 100ul