PPP2R5B,B56B
  • PPP2R5B,B56B

Anti-PPP2R5B Antibody 100ul

Ref: AN-HPA036607-100ul
Anti-PPP2R5B

Información del producto

Polyclonal Antibody against Human PPP2R5B, Gene description: protein phosphatase 2, regulatory subunit B', beta, Alternative Gene Names: B56B, FLJ35411, PR61B, Validated applications: IHC, WB, Uniprot ID: Q15173, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP2R5B
Gene Description protein phosphatase 2, regulatory subunit B', beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Immunogen GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B56B, FLJ35411, PR61B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15173
HTS Code 3002150000
Gene ID 5526
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP2R5B Antibody 100ul

Anti-PPP2R5B Antibody 100ul