TPPP,p25,p25alpha
  • TPPP,p25,p25alpha

Anti-TPPP Antibody 25ul

Ref: AN-HPA036575-25ul
Anti-TPPP

Información del producto

Polyclonal Antibody against Human TPPP, Gene description: tubulin polymerization promoting protein, Alternative Gene Names: p25, p25alpha, TPPP/p25, TPPP1, Validated applications: IHC, WB, Uniprot ID: O94811, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TPPP
Gene Description tubulin polymerization promoting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC
Immunogen SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p25, p25alpha, TPPP/p25, TPPP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94811
HTS Code 3002150000
Gene ID 11076
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TPPP Antibody 25ul

Anti-TPPP Antibody 25ul