DDX46,FLJ25329
  • DDX46,FLJ25329

Anti-DDX46 Antibody 100ul

Ref: AN-HPA036554-100ul
Anti-DDX46

Información del producto

Polyclonal Antibody against Human DDX46, Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46, Alternative Gene Names: FLJ25329, KIAA0801, Prp5, PRPF5, Validated applications: IHC, WB, Uniprot ID: Q7L014, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDX46
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Immunogen KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ25329, KIAA0801, Prp5, PRPF5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L014
HTS Code 3002150000
Gene ID 9879
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DDX46 Antibody 100ul

Anti-DDX46 Antibody 100ul