PCDHGA1
  • PCDHGA1

Anti-PCDHGA1 Antibody 25ul

Ref: AN-HPA036547-25ul
Anti-PCDHGA1

Información del producto

Polyclonal Antibody against Human PCDHGA1, Gene description: protocadherin gamma subfamily A, 1, Alternative Gene Names: PCDH-GAMMA-A1, Validated applications: IHC, WB, Uniprot ID: Q9Y5H4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCDHGA1
Gene Description protocadherin gamma subfamily A, 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKV
Immunogen TYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PCDH-GAMMA-A1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5H4
HTS Code 3002150000
Gene ID 56114
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCDHGA1 Antibody 25ul

Anti-PCDHGA1 Antibody 25ul