HOMER1,HOMER-1B
  • HOMER1,HOMER-1B

Anti-HOMER1 Antibody 100ul

Ref: AN-HPA036521-100ul
Anti-HOMER1

Información del producto

Polyclonal Antibody against Human HOMER1, Gene description: homer homolog 1 (Drosophila), Alternative Gene Names: HOMER-1B, SYN47, Ves-1, Validated applications: IHC, Uniprot ID: Q86YM7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HOMER1
Gene Description homer homolog 1 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATL
Immunogen MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOMER-1B, SYN47, Ves-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86YM7
HTS Code 3002150000
Gene ID 9456
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HOMER1 Antibody 100ul

Anti-HOMER1 Antibody 100ul