SH3PXD2B,FLJ20831
  • SH3PXD2B,FLJ20831

Anti-SH3PXD2B Antibody 100ul

Ref: AN-HPA036471-100ul
Anti-SH3PXD2B

Información del producto

Polyclonal Antibody against Human SH3PXD2B, Gene description: SH3 and PX domains 2B, Alternative Gene Names: FLJ20831, KIAA1295, Validated applications: ICC, IHC, WB, Uniprot ID: A1X283, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SH3PXD2B
Gene Description SH3 and PX domains 2B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
Immunogen PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20831, KIAA1295
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A1X283
HTS Code 3002150000
Gene ID 285590
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SH3PXD2B Antibody 100ul

Anti-SH3PXD2B Antibody 100ul