NR1H3,LXR-a,RLD-1
  • NR1H3,LXR-a,RLD-1

Anti-NR1H3 Antibody 100ul

Ref: AN-HPA036443-100ul
Anti-NR1H3

Información del producto

Polyclonal Antibody against Human NR1H3, Gene description: nuclear receptor subfamily 1, group H, member 3, Alternative Gene Names: LXR-a, RLD-1, Validated applications: IHC, WB, Uniprot ID: Q13133, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NR1H3
Gene Description nuclear receptor subfamily 1, group H, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
Immunogen MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LXR-a, RLD-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13133
HTS Code 3002150000
Gene ID 10062
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NR1H3 Antibody 100ul

Anti-NR1H3 Antibody 100ul