LCP2,SLP-76,SLP76
  • LCP2,SLP-76,SLP76

Anti-LCP2 Antibody 100ul

Ref: AN-HPA036397-100ul
Anti-LCP2

Información del producto

Polyclonal Antibody against Human LCP2, Gene description: lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa), Alternative Gene Names: SLP-76, SLP76, Validated applications: IHC, WB, Uniprot ID: Q13094, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LCP2
Gene Description lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKT
Immunogen PNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SLP-76, SLP76
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13094
HTS Code 3002150000
Gene ID 3937
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LCP2 Antibody 100ul

Anti-LCP2 Antibody 100ul