DNAH6,Dnahc6,DNHL1
  • DNAH6,Dnahc6,DNHL1

Anti-DNAH6 Antibody 100ul

Ref: AN-HPA036391-100ul
Anti-DNAH6

Información del producto

Polyclonal Antibody against Human DNAH6, Gene description: dynein, axonemal, heavy chain 6, Alternative Gene Names: Dnahc6, DNHL1, FLJ37357, HL-2, Validated applications: IHC, Uniprot ID: Q9C0G6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DNAH6
Gene Description dynein, axonemal, heavy chain 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
Immunogen TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Dnahc6, DNHL1, FLJ37357, HL-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0G6
HTS Code 3002150000
Gene ID 1768
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DNAH6 Antibody 100ul

Anti-DNAH6 Antibody 100ul