CCDC30,FLJ20972
  • CCDC30,FLJ20972

Anti-CCDC30 Antibody 100ul

Ref: AN-HPA036345-100ul
Anti-CCDC30

Información del producto

Polyclonal Antibody against Human CCDC30, Gene description: coiled-coil domain containing 30, Alternative Gene Names: FLJ20972, LOC728621, PFD6L, Validated applications: IHC, Uniprot ID: Q5VVM6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC30
Gene Description coiled-coil domain containing 30
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AQHPSSGEKLKYNQPGEVQQLHQNLHRLQILCNSAENELRYERGQNLDLKQHNSLLQEENIKIKIELKHAQQKLLDSTKMCSSLTAEYKHCQQKIKELEL
Immunogen AQHPSSGEKLKYNQPGEVQQLHQNLHRLQILCNSAENELRYERGQNLDLKQHNSLLQEENIKIKIELKHAQQKLLDSTKMCSSLTAEYKHCQQKIKELEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20972, LOC728621, PFD6L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VVM6
HTS Code 3002150000
Gene ID 728621
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC30 Antibody 100ul

Anti-CCDC30 Antibody 100ul