AN-HPA036322-25ul
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 25ul |
Gene Name | GUSB |
Gene Description | glucuronidase, beta |
Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Shipping Conditions | Normally shipped at ambient temperature |
Species Reactivity Cross | Human |
Applications | ICC, IHC, WB |
Sequence | GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS |
Immunogen | GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS |
Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Product Group | Polyclonal Antibodies |
Category | Polyclonal |
Isoelectric Point | IgG |
Host | RABBIT |
UniProt ID | P08236 |
HTS Code | 3002150000 |
Gene ID | 2990 |
Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification | Affinity purified using the PrEST antigen as affinity ligand |
Iso type | IgG |
Aplicativo | ICC, IHC, WB |
Conjugation | Unconjugated |