LARP1B,DKFZp434K245
  • LARP1B,DKFZp434K245

Anti-LARP1B Antibody 100ul

Ref: AN-HPA036280-100ul
Anti-LARP1B

Información del producto

Polyclonal Antibody against Human LARP1B, Gene description: La ribonucleoprotein domain family, member 1B, Alternative Gene Names: DKFZp434K245, DKFZp686E0316, FLJ10378, LARP2, Validated applications: ICC, IHC, Uniprot ID: Q659C4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LARP1B
Gene Description La ribonucleoprotein domain family, member 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSEGGNIRGSF
Immunogen KHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSEGGNIRGSF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434K245, DKFZp686E0316, FLJ10378, LARP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q659C4
HTS Code 3002150000
Gene ID 55132
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LARP1B Antibody 100ul

Anti-LARP1B Antibody 100ul