EIF2A,EIF-2A
  • EIF2A,EIF-2A

Anti-EIF2A Antibody 100ul

Ref: AN-HPA036256-100ul
Anti-EIF2A

Información del producto

Polyclonal Antibody against Human EIF2A, Gene description: eukaryotic translation initiation factor 2A, 65kDa, Alternative Gene Names: EIF-2A, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BY44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EIF2A
Gene Description eukaryotic translation initiation factor 2A, 65kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA
Immunogen VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIF-2A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BY44
HTS Code 3002150000
Gene ID 83939
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF2A Antibody 100ul

Anti-EIF2A Antibody 100ul