CCDC152,LOC100129792
  • CCDC152,LOC100129792

Anti-CCDC152 Antibody 25ul

Ref: AN-HPA036240-25ul
Anti-CCDC152

Información del producto

Polyclonal Antibody against Human CCDC152, Gene description: coiled-coil domain containing 152, Alternative Gene Names: LOC100129792, Validated applications: ICC, IHC, Uniprot ID: Q4G0S7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCDC152
Gene Description coiled-coil domain containing 152
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF
Immunogen KEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LOC100129792
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4G0S7
HTS Code 3002150000
Gene ID 100129792
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC152 Antibody 25ul

Anti-CCDC152 Antibody 25ul