TOMM40,C19orf1
  • TOMM40,C19orf1

Anti-TOMM40 Antibody 25ul

Ref: AN-HPA036231-25ul
Anti-TOMM40

Información del producto

Polyclonal Antibody against Human TOMM40, Gene description: translocase of outer mitochondrial membrane 40 homolog (yeast), Alternative Gene Names: C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40, Validated applications: ICC, IHC, WB, Uniprot ID: O96008, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TOMM40
Gene Description translocase of outer mitochondrial membrane 40 homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
Immunogen FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O96008
HTS Code 3002150000
Gene ID 10452
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TOMM40 Antibody 25ul

Anti-TOMM40 Antibody 25ul