CRIP3,bA480N24.2
  • CRIP3,bA480N24.2

Anti-CRIP3 Antibody 100ul

Ref: AN-HPA036198-100ul
Anti-CRIP3

Información del producto

Polyclonal Antibody against Human CRIP3, Gene description: cysteine-rich protein 3, Alternative Gene Names: bA480N24.2, TLP, TLP-A, Validated applications: ICC, IHC, WB, Uniprot ID: Q6Q6R5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CRIP3
Gene Description cysteine-rich protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence CYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRP
Immunogen CYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA480N24.2, TLP, TLP-A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6Q6R5
HTS Code 3002150000
Gene ID 401262
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CRIP3 Antibody 100ul

Anti-CRIP3 Antibody 100ul