ASNSD1,FLJ20752
  • ASNSD1,FLJ20752

Anti-ASNSD1 Antibody 25ul

Ref: AN-HPA036133-25ul
Anti-ASNSD1

Información del producto

Polyclonal Antibody against Human ASNSD1, Gene description: asparagine synthetase domain containing 1, Alternative Gene Names: FLJ20752, NBLA00058, NS3TP1, Validated applications: IHC, WB, Uniprot ID: Q9NWL6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ASNSD1
Gene Description asparagine synthetase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NQWQEVPASGLFRIDLKSTVISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKPVVPLNMMLPQAALETHCSNISNVP
Immunogen NQWQEVPASGLFRIDLKSTVISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKPVVPLNMMLPQAALETHCSNISNVP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20752, NBLA00058, NS3TP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWL6
HTS Code 3002150000
Gene ID 54529
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ASNSD1 Antibody 25ul

Anti-ASNSD1 Antibody 25ul