IL1RAPL2,IL-1R9
  • IL1RAPL2,IL-1R9

Anti-IL1RAPL2 Antibody 100ul

Ref: AN-HPA036128-100ul
Anti-IL1RAPL2

Información del producto

Polyclonal Antibody against Human IL1RAPL2, Gene description: interleukin 1 receptor accessory protein-like 2, Alternative Gene Names: IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1, Validated applications: IHC, WB, Uniprot ID: Q9NP60, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IL1RAPL2
Gene Description interleukin 1 receptor accessory protein-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
Immunogen TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NP60
HTS Code 3002150000
Gene ID 26280
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IL1RAPL2 Antibody 100ul

Anti-IL1RAPL2 Antibody 100ul