DNAJB14,FLJ14281
  • DNAJB14,FLJ14281

Anti-DNAJB14 Antibody 100ul

Ref: AN-HPA036016-100ul
Anti-DNAJB14

Información del producto

Polyclonal Antibody against Human DNAJB14, Gene description: DnaJ (Hsp40) homolog, subfamily B, member 14, Alternative Gene Names: FLJ14281, Validated applications: IHC, WB, Uniprot ID: Q8TBM8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DNAJB14
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
Immunogen RKPSGSGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14281
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBM8
HTS Code 3002150000
Gene ID 79982
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DNAJB14 Antibody 100ul

Anti-DNAJB14 Antibody 100ul