MED31,CGI-125,Soh1
  • MED31,CGI-125,Soh1

Anti-MED31 Antibody 100ul

Ref: AN-HPA035947-100ul
Anti-MED31

Información del producto

Polyclonal Antibody against Human MED31, Gene description: mediator complex subunit 31, Alternative Gene Names: CGI-125, Soh1, Validated applications: ICC, IHC, Uniprot ID: Q9Y3C7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MED31
Gene Description mediator complex subunit 31
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
Immunogen AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-125, Soh1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3C7
HTS Code 3002150000
Gene ID 51003
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MED31 Antibody 100ul

Anti-MED31 Antibody 100ul