NAA11,ARD1B,ARD2
  • NAA11,ARD1B,ARD2

Anti-NAA11 Antibody 100ul

Ref: AN-HPA035922-100ul
Anti-NAA11

Información del producto

Polyclonal Antibody against Human NAA11, Gene description: N(alpha)-acetyltransferase 11, NatA catalytic subunit, Alternative Gene Names: ARD1B, ARD2, hARD2, Validated applications: IHC, Uniprot ID: Q9BSU3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NAA11
Gene Description N(alpha)-acetyltransferase 11, NatA catalytic subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE
Immunogen DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARD1B, ARD2, hARD2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BSU3
HTS Code 3002150000
Gene ID 84779
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NAA11 Antibody 100ul

Anti-NAA11 Antibody 100ul