UBTD2,DC-UbP
  • UBTD2,DC-UbP

Anti-UBTD2 Antibody 25ul

Ref: AN-HPA035892-25ul
Anti-UBTD2

Información del producto

Polyclonal Antibody against Human UBTD2, Gene description: ubiquitin domain containing 2, Alternative Gene Names: DC-UbP, MGC30022, Validated applications: IHC, WB, Uniprot ID: Q8WUN7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UBTD2
Gene Description ubiquitin domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPV
Immunogen TVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DC-UbP, MGC30022
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUN7
HTS Code 3002150000
Gene ID 92181
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBTD2 Antibody 25ul

Anti-UBTD2 Antibody 25ul