LEXM,C1orf177
  • LEXM,C1orf177

Anti-LEXM Antibody 100ul

Ref: AN-HPA035890-100ul
Anti-LEXM

Información del producto

Polyclonal Antibody against Human LEXM, Gene description: lymphocyte expansion molecule, Alternative Gene Names: C1orf177, FLJ40201, LEM, Validated applications: IHC, WB, Uniprot ID: Q3ZCV2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LEXM
Gene Description lymphocyte expansion molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCPRTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGA
Immunogen SKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCPRTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf177, FLJ40201, LEM
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3ZCV2
HTS Code 3002150000
Gene ID 163747
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LEXM Antibody 100ul

Anti-LEXM Antibody 100ul