ABHD5,CGI-58,NCIE2
  • ABHD5,CGI-58,NCIE2

Anti-ABHD5 Antibody 100ul

Ref: AN-HPA035852-100ul
Anti-ABHD5

Información del producto

Polyclonal Antibody against Human ABHD5, Gene description: abhydrolase domain containing 5, Alternative Gene Names: CGI-58, NCIE2, Validated applications: IHC, WB, Uniprot ID: Q8WTS1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABHD5
Gene Description abhydrolase domain containing 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEI
Immunogen MTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-58, NCIE2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WTS1
HTS Code 3002150000
Gene ID 51099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABHD5 Antibody 100ul

Anti-ABHD5 Antibody 100ul