GTF3C2,KIAA0011
  • GTF3C2,KIAA0011

Anti-GTF3C2 Antibody 25ul

Ref: AN-HPA035836-25ul
Anti-GTF3C2

Información del producto

Polyclonal Antibody against Human GTF3C2, Gene description: general transcription factor IIIC, polypeptide 2, beta 110kDa, Alternative Gene Names: KIAA0011, TFIIIC110, Validated applications: IHC, WB, Uniprot ID: Q8WUA4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GTF3C2
Gene Description general transcription factor IIIC, polypeptide 2, beta 110kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGFSPTSH
Immunogen LRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGFSPTSH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0011, TFIIIC110
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUA4
HTS Code 3002150000
Gene ID 2976
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTF3C2 Antibody 25ul

Anti-GTF3C2 Antibody 25ul