NFU1,CGI-33,HIRIP5
  • NFU1,CGI-33,HIRIP5

Anti-NFU1 Antibody 25ul

Ref: AN-HPA035826-25ul
Anti-NFU1

Información del producto

Polyclonal Antibody against Human NFU1, Gene description: NFU1 iron-sulfur cluster scaffold, Alternative Gene Names: CGI-33, HIRIP5, NifU, NIFUC, Validated applications: ICC, IHC, Uniprot ID: Q9UMS0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NFU1
Gene Description NFU1 iron-sulfur cluster scaffold
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD
Immunogen PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-33, HIRIP5, NifU, NIFUC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UMS0
HTS Code 3002150000
Gene ID 27247
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NFU1 Antibody 25ul

Anti-NFU1 Antibody 25ul