PCDHGB3
  • PCDHGB3

Anti-PCDHGB3 Antibody 25ul

Ref: AN-HPA035823-25ul
Anti-PCDHGB3

Información del producto

Polyclonal Antibody against Human PCDHGB3, Gene description: protocadherin gamma subfamily B, 3, Alternative Gene Names: PCDH-GAMMA-B3, Validated applications: IHC, Uniprot ID: Q9Y5G1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCDHGB3
Gene Description protocadherin gamma subfamily B, 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEA
Immunogen FTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PCDH-GAMMA-B3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5G1
HTS Code 3002150000
Gene ID 56102
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCDHGB3 Antibody 25ul

Anti-PCDHGB3 Antibody 25ul