PCDHA12,PCDH-ALPHA12
  • PCDHA12,PCDH-ALPHA12

Anti-PCDHA12 Antibody 100ul

Ref: AN-HPA035812-100ul
Anti-PCDHA12

Información del producto

Polyclonal Antibody against Human PCDHA12, Gene description: protocadherin alpha 12, Alternative Gene Names: PCDH-ALPHA12, Validated applications: ICC, IHC, Uniprot ID: Q9UN75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCDHA12
Gene Description protocadherin alpha 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV
Immunogen LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PCDH-ALPHA12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UN75
HTS Code 3002150000
Gene ID 56137
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCDHA12 Antibody 100ul

Anti-PCDHA12 Antibody 100ul