ALS2CR12
  • ALS2CR12

Anti-ALS2CR12 Antibody 25ul

Ref: AN-HPA035793-25ul
Anti-ALS2CR12

Información del producto

Polyclonal Antibody against Human ALS2CR12, Gene description: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12, Validated applications: ICC, Uniprot ID: Q96Q35, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ALS2CR12
Gene Description amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
Immunogen HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96Q35
HTS Code 3002150000
Gene ID 130540
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ALS2CR12 Antibody 25ul

Anti-ALS2CR12 Antibody 25ul