MALRD1,bA265G8.2 View larger

Anti-MALRD1 Antibody 25ul

AN-HPA035732-25ul

New product

Anti-MALRD1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 25ul
Gene Name MALRD1
Gene Description MAM and LDL receptor class A domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SSGSKEGSVARITTSKSFPASLGMCTVRFWFYMIDPRSMGILKVYTIEESGLNILVWSVIGNK
Immunogen SSGSKEGSVARITTSKSFPASLGMCTVRFWFYMIDPRSMGILKVYTIEESGLNILVWSVIGNK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA265G8.2, C10orf112, Diet1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VYJ5
HTS Code 3002150000
Gene ID 340895
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human MALRD1, Gene description: MAM and LDL receptor class A domain containing 1, Alternative Gene Names: bA265G8.2, C10orf112, Diet1, Validated applications: ICC, Uniprot ID: Q5VYJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image