HDDC2,C6orf74
  • HDDC2,C6orf74

Anti-HDDC2 Antibody 25ul

Ref: AN-HPA035677-25ul
Anti-HDDC2

Información del producto

Polyclonal Antibody against Human HDDC2, Gene description: HD domain containing 2, Alternative Gene Names: C6orf74, CGI-130, dJ167O5.2, Validated applications: ICC, IHC, Uniprot ID: Q7Z4H3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HDDC2
Gene Description HD domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MASVSSATFSGHGARSLLQFLLLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLP
Immunogen MASVSSATFSGHGARSLLQFLLLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf74, CGI-130, dJ167O5.2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z4H3
HTS Code 3002150000
Gene ID 51020
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HDDC2 Antibody 25ul

Anti-HDDC2 Antibody 25ul