IL36B,FIL1
  • IL36B,FIL1

Anti-IL36B Antibody 100ul

Ref: AN-HPA035664-100ul
Anti-IL36B

Información del producto

Polyclonal Antibody against Human IL36B, Gene description: interleukin 36, beta, Alternative Gene Names: FIL1, FILI-(ETA), IL-1F8, IL-1H2, IL1-ETA, IL1F8, IL1H2, MGC126880, MGC126882, Validated applications: IHC, WB, Uniprot ID: Q9NZH7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IL36B
Gene Description interleukin 36, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP
Immunogen PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FIL1, FILI-(ETA), IL-1F8, IL-1H2, IL1-ETA, IL1F8, IL1H2, MGC126880, MGC126882
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZH7
HTS Code 3002150000
Gene ID 27177
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IL36B Antibody 100ul

Anti-IL36B Antibody 100ul