UTP3,CRLZ1 View larger

Anti-UTP3 Antibody 25ul

AN-HPA035655-25ul

New product

Anti-UTP3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25ul
Gene Name UTP3
Gene Description UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ
Immunogen LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRLZ1, DKFZp761F222, FLJ23256, SAS10
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQZ2
HTS Code 3002150000
Gene ID 57050
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human UTP3, Gene description: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae), Alternative Gene Names: CRLZ1, DKFZp761F222, FLJ23256, SAS10, Validated applications: ICC, IHC, Uniprot ID: Q9NQZ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image