NME5,nm23-H5,RSPH23
  • NME5,nm23-H5,RSPH23

Anti-NME5 Antibody 100ul

Ref: AN-HPA035648-100ul
Anti-NME5

Información del producto

Polyclonal Antibody against Human NME5, Gene description: NME/NM23 family member 5, Alternative Gene Names: nm23-H5, RSPH23, Validated applications: ICC, Uniprot ID: P56597, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NME5
Gene Description NME/NM23 family member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Immunogen FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names nm23-H5, RSPH23
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56597
HTS Code 3002150000
Gene ID 8382
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NME5 Antibody 100ul

Anti-NME5 Antibody 100ul