PAFAH1B3
  • PAFAH1B3

Anti-PAFAH1B3 Antibody 100ul

Ref: AN-HPA035639-100ul
Anti-PAFAH1B3

Información del producto

Polyclonal Antibody against Human PAFAH1B3, Gene description: platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa), Validated applications: ICC, IHC, WB, Uniprot ID: Q15102, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PAFAH1B3
Gene Description platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
Immunogen KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15102
HTS Code 3002150000
Gene ID 5050
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PAFAH1B3 Antibody 100ul

Anti-PAFAH1B3 Antibody 100ul